PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Traes_2DS_C83B7F5CF.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family FAR1
Protein Properties Length: 712aa    MW: 81620.7 Da    PI: 7.4745
Description FAR1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Traes_2DS_C83B7F5CF.1genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA43.93.3e-144581135
                   GATA  1 CsnCgttk..TplWRrgpdgnktLCnaCGlyyrkkgl 35
                           C  Cg +   Tp++Rrgpdg++tLCnaCG+ yrk ++
  Traes_2DS_C83B7F5CF.1 45 CLRCGISGnaTPHMRRGPDGPRTLCNACGIAYRKGKM 81
                           5667777777************************876 PP

2FAR183.73e-26115202191
                   FAR1   1 kfYneYAkevGFsvrkskskkskrngeitkrtfvCskegkreeekkktekerrtraetrtgCkaklkvkkekdgkwevtkleleHnHe 88 
                            +fYn+YA +vGFsvrks+s+ks++n  ++ rtfvCs+eg+++++k+   +++++r  tr+gC a+l +k + + k++vt+++ eHnH+
  Traes_2DS_C83B7F5CF.1 115 EFYNKYAGHVGFSVRKSTSHKSSENI-TKVRTFVCSREGYNRDKKSL--EAKKPRLDTRIGCPARLIIKVTPECKYRVTDFKAEHNHQ 199
                            6*********************6666.899*************9988..99************************************* PP

                   FAR1  89 lap 91 
                            lap
  Traes_2DS_C83B7F5CF.1 200 LAP 202
                            986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF577162.14E-104091No hitNo description
SMARTSM004016.5E-64194IPR000679Zinc finger, GATA-type
CDDcd002028.99E-84482No hitNo description
Gene3DG3DSA:3.30.50.103.8E-114483IPR013088Zinc finger, NHR/GATA-type
PfamPF003201.2E-114580IPR000679Zinc finger, GATA-type
PfamPF031011.6E-23115202IPR004330FAR1 DNA binding domain
PfamPF105512.2E-26325419IPR018289MULE transposase domain
PROSITE profilePS509669.977604640IPR007527Zinc finger, SWIM-type
PfamPF044349.5E-7610639IPR007527Zinc finger, SWIM-type
SMARTSM005755.4E-6615642IPR006564Zinc finger, PMZ-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 712 aa     Download sequence    Send to blast
MMHMLVASDG GGGEMHPYAA VPAEQELELH RDNAADDSLD GHVRCLRCGI SGNATPHMRR  60
GPDGPRTLCN ACGIAYRKGK MRRMIEAEPP IDEASLAKLV PEVDMEFESE EKAYEFYNKY  120
AGHVGFSVRK STSHKSSENI TKVRTFVCSR EGYNRDKKSL EAKKPRLDTR IGCPARLIIK  180
VTPECKYRVT DFKAEHNHQL APPSTMHMLR SQRILTELQS GEAELSDDSV VTPTTKATGD  240
LVVRQVGFLR SVSLLPADYK NYLRSKRTKA MQPGDGGAIL KYLQTMQMDN PSFFYTMQID  300
EDDKLTNFFW ADPKSREDFT YFDDVLCLDT TYKINGYGRP LALFLGVNHH RQTIIFGAAM  360
LYDESFESYK WLFESFKIAM HGKQPAVALI DQSIQLSSAM AAAWPNTAQR VCAWHVYQNS  420
VKHLNQVFQG SKTFAKDFSK CVFGYEEEEE FVFAWRSMLE KYDLRHNEWL SKLFDERERW  480
ALAYDRHIFC ADIISSLQAE SFSSILKKFL SPQLDLLSFF KHYERAVDEH RYAELQADFQ  540
ASQSYPRIPP AKMLKQTSHT YTPVVFEIFR KEFELFMDSV LFTCGEAGTT SDYKVAPSER  600
PKEHFVRFNS SDNSCMCTCK KFEFMGIPCC HMLKVLDYRN IKELPQIYLL KRWRRTAKST  660
DEDSQGHAAN DNRSSLNVSV PSANHHGLQS INARIQDTPL SNMHENPFHR SS
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3583410.0AK358341.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, partial cds, clone: NIASHv1074F13.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010235320.10.0PREDICTED: protein FAR1-RELATED SEQUENCE 5-like
RefseqXP_010235328.10.0PREDICTED: protein FAR1-RELATED SEQUENCE 5-like
TrEMBLW5C8E40.0W5C8E4_WHEAT; Uncharacterized protein
STRINGMLOC_70827.20.0(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP1832967
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G38180.11e-119FAR1-related sequence 5
Publications ? help Back to Top
  1. Brenchley R, et al.
    Analysis of the bread wheat genome using whole-genome shotgun sequencing.
    Nature, 2012. 491(7426): p. 705-10
    [PMID:23192148]